Bacterial taxon 223926
Locus VP_1167
Protein BAC59430.1
peptide ABC transporter, ATP-binding protein
Vibrio parahaemolyticus RIMD 2210633
Length 260 aa, Gene n/a, UniProt Q87QI2
>BAC59430.1|Vibrio parahaemolyticus RIMD 2210633|peptide ABC transporter, ATP-binding protein
MSALLEVDNLSKQFVTRSRLFRRQVNEAVKPVSFTLEPGQTIGFIGQNGSGKSTLARMLAGVVEPSSGEIRVNGERLEHKDYATRCKLIRMIFQDPNTSLNPRIQIGRILEGPLKRNTNMPPDARMKRVKETLLRVGLLPEHAYFYPQMLAAGQKQRVCLARALILQPSIIVADEALNGLDMAMRSQIINLFLELQEEMGLSFVYVSQHIGIVKHITDKVMVMHEGEVVEFGETNQVLTNPEHAITQRLVESHFYKAPSH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -4.66 | 0.0003 | ●●●●○ -3.76 | -3.7584808027438608 | 27185914 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)