Bacterial taxon 223926
Locus VP_0738
Protein BAC59001.1
peptidyl-tRNA hydrolase
Vibrio parahaemolyticus RIMD 2210633
Length 196 aa, Gene pth, UniProt Q87RN9
>BAC59001.1|Vibrio parahaemolyticus RIMD 2210633|peptidyl-tRNA hydrolase
MTQPIKLLVGLANPGPEYAKTRHNAGAWVVEELARVHNVTLKNEPKFFGLTGRIMVNGQDLRLLIPTTFMNLSGKAIAALAKFYQIKPEEIMVAHDELDLPPGVAKFKKGGGHGGHNGLRDTISKLGNNKDFYRLRIGIGHPGHKDKVAGFVLGKAPAKEQELLDAAADEAVRSLDILIKDGLSKAQNRLHTFKAE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -2.83 | 0.034 | ●●●○○ -2.16 | -2.1609116635302934 | 27185914 |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)