Bacterial taxon 223926
Locus VP_3036
Protein BAC61299.1
phosphoribosylaminoimidazole carboxylase, catalytic subunit
Vibrio parahaemolyticus RIMD 2210633
Length 161 aa, Gene purE, UniProt Q87KE1
>BAC61299.1|Vibrio parahaemolyticus RIMD 2210633|phosphoribosylaminoimidazole carboxylase, catalytic subunit
MKVGIIMGSKSDWPTMKLAADMLDQFGVSYETKVVSAHRTPQLLADYASSAKERGIKVIIAGAGGAAHLPGMAAAFTSLPVLGVPVQSRALKGMDSLLSIVQMPKGIAVGTLAIGEAGAANAGILAAQILGTHDESIMAKVEAFRNEQTETVLANPNPAED
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -4.94 | 0.00012 | ●●●●● -4 | -4.001472230572597 | 27185914 |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)