Bacterial taxon 223926
Locus VP_2831
Protein BAC61094.1
protein-transport protein SecB
Vibrio parahaemolyticus RIMD 2210633
Length 154 aa, Gene secB, UniProt Q87KZ3
>BAC61094.1|Vibrio parahaemolyticus RIMD 2210633|protein-transport protein SecB
MAEAAPQEAQQNFAIQRIFLKDVSFEAPNSPVIFQKEWNPDVKLDLDTQSRELGEGVYEVVLRLTVTVKNEEETAFLCEVQQGGIFTAEQMEAGQLAHCLGAFCPNILFPYARETISSLVVKGTFPQLNLAPVNFDALFMNYLQQQAQQGEAQA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -4.19 | 0.0013 | ●●●●○ -3.34 | -3.344386221822951 | 27185914 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)