Bacterial taxon 223926
Locus VP_0793
Protein BAC59056.1
PTS system, glucose-specific IIA component
Vibrio parahaemolyticus RIMD 2210633
Length 169 aa, Gene n/a, UniProt Q87RK1
>BAC59056.1|Vibrio parahaemolyticus RIMD 2210633|PTS system, glucose-specific IIA component
MGLFDKLKKLVSDDSADAGAIEIIAPLSGEIVNIEDVPDVVFAEKIVGDGIAIKPAGNKMVAPVNGTIGKIFETNHAFSIESDDGVELFVHFGIDTVELKGEGFTRIAEEGQTVKAGDTVIEFDLALLEEKAKSTLTPVVISNMDEIKELNKLSGSVTVGETPVLRVTK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -4.8 | 0.00019 | ●●●●○ -3.88 | -3.8789159433411737 | 27185914 |
Retrieved 1 of 1 entries in 0.3 ms
(Link to these results)