Bacterial taxon 223926
Locus VPA_0124
Protein BAC61467.1
putative acetyltransferase
Vibrio parahaemolyticus RIMD 2210633
Length 156 aa, Gene n/a, UniProt Q87JX4
>BAC61467.1|Vibrio parahaemolyticus RIMD 2210633|putative acetyltransferase
MQIHIRQATPNDLDGIFQLNLQINSLHFANAPEAFVAPSEADREFLAQALENKERLFLVAEREQQILGFLTAVITQNDTVSFLIKDPICRVGTIVVDQEQKQQGIGRQLLQACEQWARDANATQVRLEVMEFNQPAQRFYDNQGFKTNSRIMLKHL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 3.68 | 1.5e-6 | ○○○○○ 5.04 | 5.040758430258396 | 27185914 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)