Bacterial taxon 223926
Locus VPA_1192
Protein BAC62535.1
putative deoxycytidylate deaminase
Vibrio parahaemolyticus RIMD 2210633
Length 154 aa, Gene n/a, UniProt Q87GX3
>BAC62535.1|Vibrio parahaemolyticus RIMD 2210633|putative deoxycytidylate deaminase
MISKWAKRFYQMAELVASWSKDPSTQVGAVITNQNRIVSVGFNGYPHGVSDSVDTDERELKYLKTLHAEENAILFSKRDLDGCDIWVTHFPCPNCAAKIIQTGISRVHCPEQSEDFLSRWGDKIQVSQDMFDQAGVEVDWLPLDDINFEDKDVR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.28 | 0.0011 | ●●●●○ -3.5 | -3.4983822808162173 | 27185914 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)