Bacterial taxon 223926
Locus VP_2666
Protein BAC60929.1
putative polysialic acid capsule expression protein
Vibrio parahaemolyticus RIMD 2210633
Length 323 aa, Gene n/a, UniProt Q87LE6
>BAC60929.1|Vibrio parahaemolyticus RIMD 2210633|putative polysialic acid capsule expression protein
MSNPFDFRTAAKQVLDIEVAALQELDKYFDEQFEQACELILSNSGKVVVMGMGKSGHIGNKIAATLASTGTSAFFVHPGEAAHGDLGMISAGDIVIAISNSGESHEILSLFPVLKRLNIKIISMTGKPESNMAKLADLHLQITVPQEACPLGLAPTSSTTATLVMGDALAVALLQARGFSAEDFALSHPGGALGRKLLLKLSDIMHFGNALPKVSPDALIRDALLEISEKGLGMTAIVDEHDAMLGIFTDGDLRRTLDKRIDIHTTAIGEVMTKNPTTAHPEMLAVEGLNLMQNKNINALILCKEDKIVGALNMHDLLKAGVM
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -4.5 | 0.0005 | ●●●●○ -3.62 | -3.616225423738058 | 27185914 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)