Bacterial taxon 223926
Locus VP_2294
Protein BAC60557.1
putative SAM-dependent methyltransferase
Vibrio parahaemolyticus RIMD 2210633
Length 251 aa, Gene n/a, UniProt Q87MG1
>BAC60557.1|Vibrio parahaemolyticus RIMD 2210633|putative SAM-dependent methyltransferase
MKPALSNKTLPHPSTWSAMNNGPWVLESIQTRLDEWCPKLFGYHMLKLGGLSCELTSCNCNIQHQVNVDIQNPLHNVIADGYELPFLEKSFDVVILAHQLDYASDPHRLLREVDRVMMDDGCLIITGFNPISFTGLASLFPWRKNNLPWSGRMFTSSRINDWLGLLNYQVIHCDRYALFPMTRYRTMWTWLENSLGDWASPAGSLYYIVARKRTYPLKPIKPHWRLKKKLTPLGVMNREGFGVKRVSSQRY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -2.73 | 0.04 | ●●●○○ -2.08 | -2.0755491923281086 | 27185914 |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)