Bacterial taxon 223926
Locus VPA_1349
Protein BAC62692.1
putative Type III secretion protein Spa33
Vibrio parahaemolyticus RIMD 2210633
Length 71 aa, Gene n/a, UniProt Q87GG7
>BAC62692.1|Vibrio parahaemolyticus RIMD 2210633|putative Type III secretion protein Spa33
MKVELDVVIAHCQLSLDELNQLSKGKMVKIEDFVQSQVMLKSGNELVATGQLFKVDDQYAVAVDFVNEVKG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.84 | 7.8e-5 | ●●●●● -4.18 | -4.181680848236258 | 27185914 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)