Bacterial taxon 223926
Locus VP_0231
Protein BAC58494.1
putative UDP-galactose phosphate transferase
Vibrio parahaemolyticus RIMD 2210633
Length 200 aa, Gene n/a, UniProt Q87T39
>BAC58494.1|Vibrio parahaemolyticus RIMD 2210633|putative UDP-galactose phosphate transferase
MMKRLFDFLVSLIALILLSPIIVLVAWKIRKKLGSPVLFRQTRPGLNGKPFEMVKFRTMKDAVDEQGNLLPDSDRMTPFGEKLRNSSLDELPGLWSVLKGDMSLVGPRPLLMRYLPLYNEEQARRHDARPGVTGWAQINGRNAISWEEKFALDVWYVDNQTFWLDIKILLLTVKKVFVKEGISADDHVTMPEFEGSKDDK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -4 | 0.0022 | ●●●●○ -3.18 | -3.1847190878955542 | 27185914 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)