Bacterial taxon 223926
Locus VPA_1322
Protein BAC62665.1
putative zinc finger protein
Vibrio parahaemolyticus RIMD 2210633
Length 98 aa, Gene n/a, UniProt Q87GJ4
>BAC62665.1|Vibrio parahaemolyticus RIMD 2210633|putative zinc finger protein
MDVFRFELIPGSKALSMEEKIPSSTLYMMEKCGYMPFDVKLDNFVKVLNANNQYDYLPIDAKQIGKLGSNSMRTQDVIELKRMYGKYYYEGVYIAWDN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -2.28 | 0.037 | ●●●○○ -2.27 | -2.2716013460495126 | 27185914 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)