Bacterial taxon 223926
Locus VP_1111
Protein BAC59374.1
putative zinc-finger containing protein
Vibrio parahaemolyticus RIMD 2210633
Length 88 aa, Gene n/a, UniProt Q87QN8
>BAC59374.1|Vibrio parahaemolyticus RIMD 2210633|putative zinc-finger containing protein
MAVGWASDDSVSQQIQNTIDDEISRVRGNIKRGESAHYCDECGDEIPEARRVAMKGVRLCIECQSTIELGSQRQGLFNRRASKDSQLR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 2.44 | 0.019 | ○○○○○ 2.42 | 2.4202587967650873 | 27185914 |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)