Bacterial taxon 223926
Locus VP_0682
Protein BAC58945.1
riboflavin synthase, beta subunit
Vibrio parahaemolyticus RIMD 2210633
Length 156 aa, Gene ribH, UniProt Q87RU4
>BAC58945.1|Vibrio parahaemolyticus RIMD 2210633|riboflavin synthase, beta subunit
MKVIEGGFPAPNAKIAIVISRFNSFINESLLSGAIDTLKRHGQVSEDNITVVRCPGAVELPLVAQRVAKTGKYDAIVSLGTVIRGGTPHFDYVCSECNKGLAQVSLEYSLPVAFGVLTVDTIDQAIERAGTKAGNKGAEAALSALEMINVLSEIDS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -4.63 | 0.00034 | ●●●●○ -3.73 | -3.7250391683994213 | 27185914 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)