Bacterial taxon 223926
Locus VP_2293
Protein BAC60556.1
ribonuclease HI
Vibrio parahaemolyticus RIMD 2210633
Length 154 aa, Gene rnhA, UniProt Q87MG2
>BAC60556.1|Vibrio parahaemolyticus RIMD 2210633|ribonuclease HI
MTKHVEIFTDGSCLGNPGPGGYGIVLRYKDVEKTLSKGYTLTTNNRMEMLAAVVALQTLKEPCRVTLTTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNADLWQALDKETARHQVDWHWVKGHAGHRENEICDELARTAAENPTEEDTGYQPS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.75 | 0.0043 | ●●●○○ -2.96 | -2.9648575905532106 | 27185914 |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)