Bacterial taxon 223926
Locus VP_0644
Protein BAC58907.1
small protein B
Vibrio parahaemolyticus RIMD 2210633
Length 161 aa, Gene smpB, UniProt Q87RY2
>BAC58907.1|Vibrio parahaemolyticus RIMD 2210633|small protein B
MAKKKSKQKAGSNTIALNKKARHEYFIEDEIEAGLELQGWEVKALRQGKANISESYVFMRDGEAFVSGMTITPLNQASTHVVANPTRVRKLLMSRRELDNLLGRINREGMTLTALSLYWSRSWVKIKIGVAKGKKLHDKRTDLKEKDWAREKARVMKSALR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -4.12 | 0.0016 | ●●●●○ -3.29 | -3.2882151392350423 | 27185914 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)