Bacterial taxon 223926
Locus VP_2348
Protein BAC60611.1
sodium-translocating NADH-quinone reductase, subunit D
Vibrio parahaemolyticus RIMD 2210633
Length 210 aa, Gene nqrD, UniProt Q87MA9
>BAC60611.1|Vibrio parahaemolyticus RIMD 2210633|sodium-translocating NADH-quinone reductase, subunit D
MSSAQNIKKSIMAPVLDNNPIALQVLGVCSALAVTTKLETAFVMTLAVTFVTALSNFSVSLIRNHIPNSVRIIVQMAIIASLVIVVDQVLKAYLYDISKQLSVFVGLIITNCIVMGRAEAFAMKSAPVPSLIDGIGNGLGYGFVLITVGFFRELFGSGKLFGMEVLPLVSNGGWYQPNGLMLLAPSAFFLIGFLIWVIRVFKPEQVEAKE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.89 | 0.003 | ●●●●○ -3.08 | -3.081178658698614 | 27185914 |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)