Bacterial taxon 223926
Locus VP_1057
Protein BAC59320.1
TolQ protein
Vibrio parahaemolyticus RIMD 2210633
Length 232 aa, Gene tolQ, UniProt Q87QU2
>BAC59320.1|Vibrio parahaemolyticus RIMD 2210633|TolQ protein
MTADISILDLFLQASLLVKLVMLTLLGMSIASWAMIIKRSKVLSQASKNAEQFEDKFWSGTDLSQLYQKVKGRKDEIAGTEEIFFAGFTEFARLRKSNANSPAYIMEGTGRAMRVAVAREVDELETSLPFLATVGSISPYIGLFGTVWGIMHAFIALGEVKQATLSMVAPGIAEALIATAMGLFAAIPAVMAYNRLSNKVSKLEHTYATFSEEFHSILHRQAMAGRDSADKE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -2.71 | 0.042 | ●●●○○ -2.06 | -2.058514001847542 | 27185914 |
Retrieved 1 of 1 entries in 8.3 ms
(Link to these results)