Bacterial taxon 223926
Locus VP_2916
Protein BAC61179.1
uroporphyrinogen decarboxylase
Vibrio parahaemolyticus RIMD 2210633
Length 355 aa, Gene hemE, UniProt Q87KR0
>BAC61179.1|Vibrio parahaemolyticus RIMD 2210633|uroporphyrinogen decarboxylase
MTELKNDRYLRALLKEPVDYTPVWMMRQAGRYLPEYKATRAQAGDFMSLCKNAELASEVTLQPLRRFPLDAAILFSDILTIPDAMGLGLRFAAGEGPVFDNPITCKADVEKIGLPDPEGELQYVMNAVRQIRKDLNGDVPLIGFSGSPWTLATYMVEGGSSKAFTKIKKMMYAEPQTLHLLLDKLADSVIDYLNAQIKAGAQSVMVFDTWGGVLTPRDYNLFSLQYMHKIVDGLIRENDGRRVPVTLFTKNGGMWLEQIAATGCDAVGLDWTINIADAKARIGDKVALQGNMDPSMLYASPERIREEVAGILEGFGDAGTGHVFNLGHGIHLDVPPENAGVFVEAVHELSKPYHK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -2.91 | 0.029 | ●●●○○ -2.23 | -2.22901143308912 | 27185914 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)