Bacterial taxon 400667 
						  Locus A1S_0218 
						  Protein ABO10693.2 
					
				
				nitrogen assimilation regulatory protein P-II 2
				Acinetobacter baumannii ATCC 17978 
				Length 112 aa, Gene n/a, UniProt n/a
					
				
				
					>ABO10693.2|Acinetobacter baumannii ATCC 17978|nitrogen assimilation regulatory protein P-II 2
MKLVTAIVKPFKLDDVREALSDIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEIAISDEMVDAVIESITRVASTGKIGDGKIFVTNLEQVIRIRTGETGPDAV
				
				 
				
			
		    
            
              
            	| Host | Tissue | Tissue Ontology | Time Post Infection | Transposon Insertion Site | Raw Fitness Score | p-Value | Fitness z-Score | Precise fitness z-Score | Reference | 
            
            
            
            | Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.54 | 2.0e-10 | ●●●●○ -3.49 | -3.4903409723281986 | 24895306 | 
              
          
		   Retrieved 1 of 1 entries in 1.4 ms
			  (Link to these results)