Bacterial taxon 400667
Locus A1S_0218
Protein ABO10693.2
nitrogen assimilation regulatory protein P-II 2
Acinetobacter baumannii ATCC 17978
Length 112 aa, Gene n/a, UniProt n/a
>ABO10693.2|Acinetobacter baumannii ATCC 17978|nitrogen assimilation regulatory protein P-II 2
MKLVTAIVKPFKLDDVREALSDIGVQGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEIAISDEMVDAVIESITRVASTGKIGDGKIFVTNLEQVIRIRTGETGPDAV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.54 | 2.0e-10 | ●●●●○ -3.49 | -3.4903409723281986 | 24895306 |
Retrieved 1 of 1 entries in 65.5 ms
(Link to these results)