Bacterial taxon 1392858
Locus CO715_10365
Protein ATI06065.1
acid shock protein
Escherichia coli M12
Length 111 aa, Gene n/a, UniProt n/a
>ATI06065.1|Escherichia coli M12|acid shock protein
MKKQIEGMTMKKVLALVVAAAMGLSSAAFAAETATTPAPTATTTKAAPAKTTHHKKQHKAAPAQKAQAAKKHHKNAKTEQKAPEQKAQAAKKHAKKHSHQQPAKPAAQPAA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.14 | 2.5e-14 | ●●○○○ -1.15 | -1.1518441334392466 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.67 | 0.006 | ●○○○○ -0.01 | -0.011385019554971062 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)