Bacterial taxon 1392858   Locus CO715_10365   Protein ATI06065.1

acid shock protein

Escherichia coli M12

Length 111 aa, Gene n/a, UniProt n/a

>ATI06065.1|Escherichia coli M12|acid shock protein
MKKQIEGMTMKKVLALVVAAAMGLSSAAFAAETATTPAPTATTTKAAPAKTTHHKKQHKAAPAQKAQAAKKHHKNAKTEQKAPEQKAQAAKKHAKKHSHQQPAKPAAQPAA

 

Protein visualisation unavailable   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus BALB/c)spleen BTO:000128124 hnot available in this study-8.142.5e-14●●○○○ -1.15-1.151844133439246629101196
Mouse (Mus musculus BALB/c)mammary gland BTO:000081724 hnot available in this study-2.670.006●○○○○ -0.01-0.01138501955497106229101196
Retrieved 2 of 2 entries in 0.8 ms (Link to these results)