Bacterial taxon 1392858
Locus CO715_07100
Protein ATI05503.1
exonuclease
Escherichia coli M12
Length 226 aa, Gene n/a, UniProt n/a
>ATI05503.1|Escherichia coli M12|exonuclease
MTPDIILQRTGIDVRAIEQGDDAWHKLRLGVITASQVHNVIAKPRSGKKWPDMKMSYFHTLLAEVCTGVAPEVNAKALAWGKQYENDARTLFEFTSGVNVTESPIIYRDESMRTACSPDGLCSDGNGLELKCPFTSRDFMKFRLGGFEAIKSAYMAQVQYSMWVTRKDAWYFANYDPRMKREGLHYVVVERDEKYMASFDEMVPEFIEKMDEALAEIGFVFGEQWR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.71 | 8.1e-14 | ●●○○○ -1.48 | -1.4790010837814611 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 0.98 | 0.021 | ○○○○○ 0.75 | 0.749546994410626 | 29101196 |
Retrieved 2 of 2 entries in 1.8 ms
(Link to these results)