Bacterial taxon 1392858   Locus CO715_07100   Protein ATI05503.1

exonuclease

Escherichia coli M12

Length 226 aa, Gene n/a, UniProt n/a

>ATI05503.1|Escherichia coli M12|exonuclease
MTPDIILQRTGIDVRAIEQGDDAWHKLRLGVITASQVHNVIAKPRSGKKWPDMKMSYFHTLLAEVCTGVAPEVNAKALAWGKQYENDARTLFEFTSGVNVTESPIIYRDESMRTACSPDGLCSDGNGLELKCPFTSRDFMKFRLGGFEAIKSAYMAQVQYSMWVTRKDAWYFANYDPRMKREGLHYVVVERDEKYMASFDEMVPEFIEKMDEALAEIGFVFGEQWR

 

Protein visualisation unavailable   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus BALB/c)mammary gland BTO:000081724 hnot available in this study-9.718.1e-14●●○○○ -1.48-1.479001083781461129101196
Mouse (Mus musculus BALB/c)spleen BTO:000128124 hnot available in this study0.980.021○○○○○ 0.750.74954699441062629101196
Retrieved 2 of 2 entries in 28.1 ms (Link to these results)