Bacterial taxon 1392858
Locus CO715_20540
Protein ATI07902.1
FMN reductase
Escherichia coli M12
Length 164 aa, Gene n/a, UniProt n/a
>ATI07902.1|Escherichia coli M12|FMN reductase
MNIVDQQTFRDAMSCMGAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSAGQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCAIEAIHRHATPYGLVWFDRSYHALMRPAC
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.39 | 0.00021 | ●●○○○ -1.62 | -1.622340895570429 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.77 | 0.0056 | ●●○○○ -1.08 | -1.0758969842526611 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)