Bacterial taxon 1392858   Locus CO715_20540   Protein ATI07902.1

FMN reductase

Escherichia coli M12

Length 164 aa, Gene n/a, UniProt n/a

>ATI07902.1|Escherichia coli M12|FMN reductase
MNIVDQQTFRDAMSCMGAAVNIITTDGPAGRAGFTASAVCSVTDTPPTLLVCLNRGASVWPVFNENRTLCVNTLSAGQEPLSNLFGGKTPMEHRFAAARWQTGVTGCPQLEEALVSFDCRISQVVSVGTHDILFCAIEAIHRHATPYGLVWFDRSYHALMRPAC

 

Protein visualisation unavailable   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus BALB/c)mammary gland BTO:000081724 hnot available in this study-10.390.00021●●○○○ -1.62-1.62234089557042929101196
Mouse (Mus musculus BALB/c)spleen BTO:000128124 hnot available in this study-7.770.0056●●○○○ -1.08-1.075896984252661129101196
Retrieved 2 of 2 entries in 55.1 ms (Link to these results)