Bacterial taxon 1392858
Locus CO715_03810
Protein ATI04943.1
hypothetical protein
Escherichia coli M12
Length 180 aa, Gene n/a, UniProt n/a
>ATI04943.1|Escherichia coli M12|hypothetical protein
MKKIALAGLAGMLLVSASVNAMSISGQAGKEYTNIGVGFGTESTGLALSGNWTHNDDDGDVAGVGLGLNLPLGPLMATVGGKGVYTNPNYGDEGYAAAVGGGLQWKIGNSFRLFGEYYYSPDSLSSGIKSYEEANAGARYTIMRPVSIEAGYRYLNLSGKDGNRDNAVADGPYVGVNASF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.57 | 2.0e-23 | ●●○○○ -1.66 | -1.6582280100212328 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.75 | 0.0019 | ●○○○○ -0.03 | -0.028076700694879886 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)