Bacterial taxon 1392858   Locus CO715_03810   Protein ATI04943.1

hypothetical protein

Escherichia coli M12

Length 180 aa, Gene n/a, UniProt n/a

>ATI04943.1|Escherichia coli M12|hypothetical protein
MKKIALAGLAGMLLVSASVNAMSISGQAGKEYTNIGVGFGTESTGLALSGNWTHNDDDGDVAGVGLGLNLPLGPLMATVGGKGVYTNPNYGDEGYAAAVGGGLQWKIGNSFRLFGEYYYSPDSLSSGIKSYEEANAGARYTIMRPVSIEAGYRYLNLSGKDGNRDNAVADGPYVGVNASF

 

Protein visualisation unavailable   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus BALB/c)mammary gland BTO:000081724 hnot available in this study-10.572.0e-23●●○○○ -1.66-1.658228010021232829101196
Mouse (Mus musculus BALB/c)spleen BTO:000128124 hnot available in this study-2.750.0019●○○○○ -0.03-0.02807670069487988629101196
Retrieved 2 of 2 entries in 9.2 ms (Link to these results)