Bacterial taxon 1392858
Locus CO715_23705
Protein ATI08448.1
hypothetical protein
Escherichia coli M12
Length 148 aa, Gene n/a, UniProt n/a
>ATI08448.1|Escherichia coli M12|hypothetical protein
MNMTKKEALAFLALNQPMPNDYDITQELINKYNNVRLYFSANPAEEAIPLFLQSFGEGDGFGVYQLVEDFLYKCDKNIIASNIANILENPLTIKSVRCWCTLLAMAFPDNTLIKGLNISLQSDDEDTRDMAMLSLKMITEEYKTFEFQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.21 | 0.035 | ○○○○○ 0.8 | 0.797744223702113 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 5.77 | 3.8e-23 | ○○○○○ 1.75 | 1.7508392167909113 | 29101196 |
Retrieved 2 of 2 entries in 1.5 ms
(Link to these results)