Bacterial taxon 1392858   Locus CO715_23705   Protein ATI08448.1

hypothetical protein

Escherichia coli M12

Length 148 aa, Gene n/a, UniProt n/a

>ATI08448.1|Escherichia coli M12|hypothetical protein
MNMTKKEALAFLALNQPMPNDYDITQELINKYNNVRLYFSANPAEEAIPLFLQSFGEGDGFGVYQLVEDFLYKCDKNIIASNIANILENPLTIKSVRCWCTLLAMAFPDNTLIKGLNISLQSDDEDTRDMAMLSLKMITEEYKTFEFQ

 

Protein visualisation unavailable   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus BALB/c)mammary gland BTO:000081724 hnot available in this study1,210,035○○○○○ 0,80.79774422370211329101196
Mouse (Mus musculus BALB/c)spleen BTO:000128124 hnot available in this study5,773,8e-23○○○○○ 1,751.750839216790911329101196
Retrieved 2 of 2 entries in 0,9 ms (Link to these results)