Bacterial taxon 1392858
Locus CO715_24680
Protein ATI08622.1
hypothetical protein
Escherichia coli M12
Length 227 aa, Gene n/a, UniProt n/a
>ATI08622.1|Escherichia coli M12|hypothetical protein
MNLKKTLLSVLIIVPLCLLAGCDYIEKASKVDDLVTQQELQKSKIEALEKQQELDKRKIEHFEKQQTTVINSTKTLASVVKAVKDKQDEFVFTEFNPAQTQYFILNNGSVGLAGRVLAIDAVENGSVIRISLVNLLSVPVSNIGFHATWGNERPTDAKALAKWQQLLFNTTMNSTLQLMPGQWQDINLTLKGVSPNNLKYLKLSINMANLQFDTVQSAETRQRKNKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.25 | 1.1e-30 | ○○○○○ 1.02 | 1.0155706625779242 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 3.79 | 6.4e-82 | ○○○○○ 1.34 | 1.3358422944499262 | 29101196 |
Retrieved 2 of 2 entries in 1.5 ms
(Link to these results)