Bacterial taxon 1392858   Locus CO715_24680   Protein ATI08622.1

hypothetical protein

Escherichia coli M12

Length 227 aa, Gene n/a, UniProt n/a

>ATI08622.1|Escherichia coli M12|hypothetical protein
MNLKKTLLSVLIIVPLCLLAGCDYIEKASKVDDLVTQQELQKSKIEALEKQQELDKRKIEHFEKQQTTVINSTKTLASVVKAVKDKQDEFVFTEFNPAQTQYFILNNGSVGLAGRVLAIDAVENGSVIRISLVNLLSVPVSNIGFHATWGNERPTDAKALAKWQQLLFNTTMNSTLQLMPGQWQDINLTLKGVSPNNLKYLKLSINMANLQFDTVQSAETRQRKNKK

 

Protein visualisation unavailable   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus BALB/c)mammary gland BTO:000081724 hnot available in this study2.251.1e-30○○○○○ 1.021.015570662577924229101196
Mouse (Mus musculus BALB/c)spleen BTO:000128124 hnot available in this study3.796.4e-82○○○○○ 1.341.335842294449926229101196
Retrieved 2 of 2 entries in 1 ms (Link to these results)