Bacterial taxon 1392858
Locus CO715_07500
Protein ATI05572.1
NAD(P)H-dependent FMN reductase
Escherichia coli M12
Length 191 aa, Gene n/a, UniProt n/a
>ATI05572.1|Escherichia coli M12|NAD(P)H-dependent FMN reductase
MRVITLAGSPRFPSRSSSLLEYAREKLNGLDVEVYHWNLQNFAPEDLLYARFDSPALKTFTEQLQQADGLIVATPVYKAAYSGALKTLLDLLPERALQGKVVLPLATGGTVAHLLAVDYALKPVLSALKAQEILHGVFADDSQVIDYHHKPQFTPNLQTRLDTALETFWQALHRRDIQVPDLLSLRGNAHA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -12.3 | 1.5e-8 | ●●●○○ -2.02 | -2.020437490757256 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.68 | 0.00025 | ●●○○○ -1.47 | -1.4725330573397466 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)