Bacterial taxon 1392858   Locus CO715_07500   Protein ATI05572.1

NAD(P)H-dependent FMN reductase

Escherichia coli M12

Length 191 aa, Gene n/a, UniProt n/a

>ATI05572.1|Escherichia coli M12|NAD(P)H-dependent FMN reductase
MRVITLAGSPRFPSRSSSLLEYAREKLNGLDVEVYHWNLQNFAPEDLLYARFDSPALKTFTEQLQQADGLIVATPVYKAAYSGALKTLLDLLPERALQGKVVLPLATGGTVAHLLAVDYALKPVLSALKAQEILHGVFADDSQVIDYHHKPQFTPNLQTRLDTALETFWQALHRRDIQVPDLLSLRGNAHA

 

Protein visualisation unavailable   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus BALB/c)mammary gland BTO:000081724 hnot available in this study-12.31.5e-8●●●○○ -2.02-2.02043749075725629101196
Mouse (Mus musculus BALB/c)spleen BTO:000128124 hnot available in this study-9.680.00025●●○○○ -1.47-1.472533057339746629101196
Retrieved 2 of 2 entries in 13 ms (Link to these results)