Bacterial taxon 1392858
Locus CO715_20215
Protein ATI07841.1
pyrimidine/purine nucleoside phosphorylase
Escherichia coli M12
Length 94 aa, Gene n/a, UniProt n/a
>ATI07841.1|Escherichia coli M12|pyrimidine/purine nucleoside phosphorylase
MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGEYTFSTAEPEEMTVISGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVAEPTSYLCRYL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.84 | 3.7e-85 | ○○○○○ 1.14 | 1.1386718109847522 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.06 | 5.9e-101 | ○○○○○ 1.19 | 1.1851998721622483 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)