Bacterial taxon 1392858   Locus CO715_20215   Protein ATI07841.1

pyrimidine/purine nucleoside phosphorylase

Escherichia coli M12

Length 94 aa, Gene n/a, UniProt n/a

>ATI07841.1|Escherichia coli M12|pyrimidine/purine nucleoside phosphorylase
MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGEYTFSTAEPEEMTVISGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVAEPTSYLCRYL
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus BALB/c)spleen BTO:000128124 hnot available in this study2.843.7e-85○○○○○ 1.141.138671810984752229101196
Mouse (Mus musculus BALB/c)mammary gland BTO:000081724 hnot available in this study3.065.9e-101○○○○○ 1.191.185199872162248329101196
Retrieved 2 of 2 entries in 65.6 ms (Link to these results)