Bacterial taxon 1308539 
						  Locus VK055_3211 
						  Protein AIK81779.1 
					
				
				hypothetical protein
				Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1 
				Length 112 aa, Gene n/a, UniProt n/a
					
				
				
					>AIK81779.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|hypothetical protein
MAESFTTTNRFFDNKNYPRGFSRHGDFTIKEAQLLERHGYAFNELELGKREPVTEDEKQFVSVCRGEREPVTEAERVWIKYMARIKRPKRFHTLSGGKPQMEGADDYTESDD
				
				 
				
			
		    
            
              
            	| Host  | 
				Tissue    | 
				Tissue Ontology | 
				Time Post Infection  | 
				Transposon Insertion Site  | 
				Raw Fitness Score    | 
				p-Value    | 
				Fitness z-Score  | 
				Precise fitness z-Score | 
				Reference   | 
              
            
            
            
            | Mouse (Mus musculus C57BL/6) | lung  | BTO:0000763 | 24 h | not available in this study | -4.78 | <1e-323 | ●●●○○ -2.35 | -2.353202827634058 | 26060277  | 
              
          
		   Retrieved 1 of 1 entries in 1.6 ms
			  (Link to these results)