Bacterial taxon 1308539
Locus VK055_3211
Protein AIK81779.1
hypothetical protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 112 aa, Gene n/a, UniProt n/a
>AIK81779.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|hypothetical protein
MAESFTTTNRFFDNKNYPRGFSRHGDFTIKEAQLLERHGYAFNELELGKREPVTEDEKQFVSVCRGEREPVTEAERVWIKYMARIKRPKRFHTLSGGKPQMEGADDYTESDD
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -4.78 | <1e-323 | ●●●○○ -2.35 | -2.353202827634058 | 26060277 |
Retrieved 1 of 1 entries in 19.2 ms
(Link to these results)