Bacterial taxon 909946
Locus STM474_1661
Protein WP_001200680.1
DUF333 domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 88 aa, Gene ydbJ, UniProt E8XJX9
>WP_001200680.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF333 domain-containing protein
MRAAFWVGCAALLLSACSSEPVQQATAAHVSPGMKAAMSSAGEANCAMIGGSLSAARQLDGSVIGMCALPNGKRCSEQSLAAGSCGSY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,698,563 | 1.4 | 0.034 | ○○○○○ 0.91 | 0.905430496639082 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,698,563 | 1.43 | 0.51 | ○○○○○ 0.92 | 0.918870706480114 | 23637626 |
Retrieved 2 of 2 entries in 0.4 ms
(Link to these results)