Bacterial taxon 909946   Locus STM474_1661   Protein WP_001200680.1

DUF333 domain-containing protein

Salmonella enterica Serovar Typhimurium ST4 74

Length 88 aa, Gene ydbJ, UniProt E8XJX9

>WP_001200680.1|Salmonella enterica Serovar Typhimurium ST4 74|DUF333 domain-containing protein
MRAAFWVGCAALLLSACSSEPVQQATAAHVSPGMKAAMSSAGEANCAMIGGSLSAARQLDGSVIGMCALPNGKRCSEQSLAAGSCGSY

 

Show protein visualisation   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Cow (Bos taurus)ileal mucosa BTO:00006194 days1,698,563 1,40,034○○○○○ 0,910.90543049663908223637626
Chicken (Gallus gallus)cecum BTO:00001664 days1,698,563 1,430,51○○○○○ 0,920.91887070648011423637626
Retrieved 2 of 2 entries in 1 ms (Link to these results)