Bacterial taxon 909946
Locus STM474_2719
Protein WP_000669690.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 133 aa, Gene n/a, UniProt E8XHJ2
>WP_000669690.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MKFKSIAKTVFLFALLTSAGFATGKNVNVEFDKGQNSARYSGVIKGYDYDTYNFQARKGQKVHVSISNEGADTYLFGPGISDSVDLSRYSSELDGNGQYTLPASGKYELKVLQTRNEARKNKAKKYSVNIQIK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,756,056 | -2.15 | 0.021 | ●○○○○ -0.94 | -0.941760023630645 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,756,056 | -1.95 | 9.3e-5 | ●○○○○ -0.84 | -0.835383029319135 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,756,056 | -0.84 | 0.82 | ●○○○○ -0.26 | -0.261360029242784 | 23637626 |
Retrieved 3 of 3 entries in 0.9 ms
(Link to these results)