Bacterial taxon 909946   Locus STM474_2719   Protein WP_000669690.1

hypothetical protein

Salmonella enterica Serovar Typhimurium ST4 74

Length 133 aa, Gene n/a, UniProt E8XHJ2

>WP_000669690.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MKFKSIAKTVFLFALLTSAGFATGKNVNVEFDKGQNSARYSGVIKGYDYDTYNFQARKGQKVHVSISNEGADTYLFGPGISDSVDLSRYSSELDGNGQYTLPASGKYELKVLQTRNEARKNKAKKYSVNIQIK

 

Show protein visualisation   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Pig (Sus scrofa)colonic mucosa BTO:00002713 days2,756,056 -2,150,021●○○○○ -0,94-0.94176002363064523637626
Cow (Bos taurus)ileal mucosa BTO:00006194 days2,756,056 -1,959,3e-5●○○○○ -0,84-0.83538302931913523637626
Chicken (Gallus gallus)cecum BTO:00001664 days2,756,056 -0,840,82●○○○○ -0,26-0.26136002924278423637626
Retrieved 3 of 3 entries in 1 ms (Link to these results)