Bacterial taxon 615 
						  Locus BVG96_21660 
						  Protein ASM00066.1 
					
				
				transcriptional activator RfaH
				Serratia marcescens Strain UMH9 
				Length 162 aa, Gene n/a, UniProt n/a
					
				
				
					>ASM00066.1|Serratia marcescens Strain UMH9|transcriptional activator RfaH
MESWYLLYCKRGQLLRAQEHLERQQVNCLSPIITLEKIVRGKRIAVSEPLFPNYLFVEFDPERIHTTTISATRGVSHFVRFGALPSVIPSKVIDELRTHASETYVDPETPQPGDTVLIVDGVFEGLQAIYTEPDGEARSMLLLNLINKQVSQSIDNRQFQKM
				
				 
				
			
		    
            
              
            	| Host | Tissue | Tissue Ontology | Time Post Infection | Transposon Insertion Site | Raw Fitness Score | p-Value | Fitness z-Score | Precise fitness z-Score | Reference | 
            
            
            
            | Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 24 h | not available in this study | -3.1 | 6.5e-6 | ●●●●○ -3.65 | -3.6543388380327917 | 28536292 | 
              
          
		   Retrieved 1 of 1 entries in 0.7 ms
			  (Link to these results)