Bacterial taxon 615
Locus BVG96_21660
Protein ASM00066.1
transcriptional activator RfaH
Serratia marcescens Strain UMH9
Length 162 aa, Gene n/a, UniProt n/a
>ASM00066.1|Serratia marcescens Strain UMH9|transcriptional activator RfaH
MESWYLLYCKRGQLLRAQEHLERQQVNCLSPIITLEKIVRGKRIAVSEPLFPNYLFVEFDPERIHTTTISATRGVSHFVRFGALPSVIPSKVIDELRTHASETYVDPETPQPGDTVLIVDGVFEGLQAIYTEPDGEARSMLLLNLINKQVSQSIDNRQFQKM
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 24 h | not available in this study | -3.1 | 6.5e-6 | ●●●●○ -3.65 | -3.6543388380327917 | 28536292 |
Retrieved 1 of 1 entries in 31.3 ms
(Link to these results)