Bacterial taxon 400667
Locus A1S_0414
Protein ABO10869.2
(di)nucleoside polyphosphate hydrolase (Ap5A pyrophosphatase)
Acinetobacter baumannii ATCC 17978
Length 161 aa, Gene rppH, UniProt A3M1S5
>ABO10869.2|Acinetobacter baumannii ATCC 17978|(di)nucleoside polyphosphate hydrolase (Ap5A pyrophosphatase)
MIDSEGFRPNVGIILANDDGQVLWAKRIGHNAWQFPQGGIQFGETPEQALFRELREEIGLLPEHVQIIAQTKGWLRYRLPHRYIRSDSDPVCIGQKQKWFLLKLTAPAKNIQLNLADPPEFDEWQWVSYWYPLGQVVNFKRDVYRKAMVELCTQLPVQQLP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.6 | 0.0051 | ●○○○○ -0.66 | -0.6585931115015669 | 24895306 |
Retrieved 1 of 1 entries in 11.1 ms
(Link to these results)