Bacterial taxon 400667
Locus A1S_3161
Protein ABO13558.1
50S ribosomal protein L19
Acinetobacter baumannii ATCC 17978
Length 122 aa, Gene rplS, UniProt A3M9G4
>ABO13558.1|Acinetobacter baumannii ATCC 17978|50S ribosomal protein L19
MSGKHPLVQAIENSQLKTDLPEFAPGDTVVVQVKVKEGDRERLQAFEGVVIAKKNRGLNSAFTVRKISSGVGVERVFQTHSPVVAKIEVKRRGDVRRAKLYYLRDLSGKAARIREKLPARKA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.89 | 0.00016 | ●●●○○ -2.53 | -2.5329997088763117 | 24895306 |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)