Bacterial taxon 400667
Locus A1S_2730
Protein ABO13143.1
50S ribosomal protein L27
Acinetobacter baumannii ATCC 17978
Length 85 aa, Gene rpmA, UniProt A3M899
>ABO13143.1|Acinetobacter baumannii ATCC 17978|50S ribosomal protein L27
MATKKAGGSTKNGRDSNPKMLGVKVYGGQTVTAGNIIVRQRGTEFHAGANVGMGRDHTLFATADGVVKFEVKGQFGRRYVKVETV
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.12 | 2.4e-7 | ●●○○○ -1.42 | -1.4196220143384195 | 24895306 |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)