Bacterial taxon 400667
Locus A1S_2423
Protein ABO12841.1
50S ribosomal protein L31
Acinetobacter baumannii ATCC 17978
Length 74 aa, Gene rpmE, UniProt A3M7E7
>ABO12841.1|Acinetobacter baumannii ATCC 17978|50S ribosomal protein L31
MRADIHPKYEKLVATCSCGNVIETRSALGKETIYLDVCSACHPFYTGKQKNVDTGGRIDKFKQRFAGMSRSIKR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.45 | 3.2e-12 | ●●○○○ -1.9 | -1.904283981641086 | 24895306 |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)