Bacterial taxon 400667
Locus A1S_1761
Protein ABO12188.2
acetyltransferase
Acinetobacter baumannii ATCC 17978
Length 172 aa, Gene n/a, UniProt n/a
>ABO12188.2|Acinetobacter baumannii ATCC 17978|acetyltransferase
MKDIEILEINEIGDHEQGLSLLLEDSVNNGASIGFLAPIEKNEVLNYWREVNHKLAQGNSRLWIAIQEGTVVGSVQLSLVSKKNGVHRAEVEKLMVLTSARKQGIATLLLNELENFSKEKGLRLLVLDTREGDVSELLYSKIGFVRVGVIPNFALSSNGNYDGTAIYYKKLV
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.67 | 0.0014 | ○○○○○ 1.19 | 1.186267525625685 | 24895306 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)